Lineage for d1pmkb_ (1pmk B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033340Protein Plasminogen [63400] (1 species)
  7. 3033341Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 3033365Domain d1pmkb_: 1pmk B: [44636]
    kringle 4

Details for d1pmkb_

PDB Entry: 1pmk (more details), 2.25 Å

PDB Description: kringle-kringle interactions in multimer kringle structures
PDB Compounds: (B:) plasminogen kringle 4

SCOPe Domain Sequences for d1pmkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmkb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
cyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgpw
cfttdpsvrweycnlkkc

SCOPe Domain Coordinates for d1pmkb_:

Click to download the PDB-style file with coordinates for d1pmkb_.
(The format of our PDB-style files is described here.)

Timeline for d1pmkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pmka_