Lineage for d1pmlb_ (1pml B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143909Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 143910Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 143911Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 143957Protein Plasminogen kringles [63400] (1 species)
  7. 143958Species Human (Homo sapiens) [TaxId:9606] [63401] (9 PDB entries)
  8. 143963Domain d1pmlb_: 1pml B: [44633]

Details for d1pmlb_

PDB Entry: 1pml (more details), 2.38 Å

PDB Description: kringle-kringle interactions in multimer kringle structures

SCOP Domain Sequences for d1pmlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmlb_ g.14.1.1 (B:) Plasminogen kringles {Human (Homo sapiens)}
sdcyfgngsayrgthsltesgasclpwnsmiligkvytaqnpsaqalglgkhnycrnpdg
dakpwchvlknrrltweycdvpscst

SCOP Domain Coordinates for d1pmlb_:

Click to download the PDB-style file with coordinates for d1pmlb_.
(The format of our PDB-style files is described here.)

Timeline for d1pmlb_: