Lineage for d1pk4__ (1pk4 -)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522773Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 522774Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 522775Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 522812Protein Plasminogen [63400] (1 species)
  7. 522813Species Human (Homo sapiens) [TaxId:9606] [63401] (16 PDB entries)
  8. 522815Domain d1pk4__: 1pk4 - [44630]
    kringle 4

Details for d1pk4__

PDB Entry: 1pk4 (more details), 1.9 Å

PDB Description: crystal and molecular structure of human plasminogen kringle 4 refined at 1.9-angstroms resolution

SCOP Domain Sequences for d1pk4__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pk4__ g.14.1.1 (-) Plasminogen {Human (Homo sapiens)}
dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
wcfttdpsvrweycnlkkc

SCOP Domain Coordinates for d1pk4__:

Click to download the PDB-style file with coordinates for d1pk4__.
(The format of our PDB-style files is described here.)

Timeline for d1pk4__: