Lineage for d1krna_ (1krn A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638080Protein Plasminogen [63400] (1 species)
  7. 2638081Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 2638082Domain d1krna_: 1krn A: [44629]
    kringle 4
    complexed with so4

Details for d1krna_

PDB Entry: 1krn (more details), 1.67 Å

PDB Description: structure of kringle 4 at 4c temperature and 1.67 angstroms resolution
PDB Compounds: (A:) plasminogen

SCOPe Domain Sequences for d1krna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1krna_ g.14.1.1 (A:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
wcfttdpsvrweycnlkkc

SCOPe Domain Coordinates for d1krna_:

Click to download the PDB-style file with coordinates for d1krna_.
(The format of our PDB-style files is described here.)

Timeline for d1krna_: