Lineage for d2plh__ (2plh -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40610Fold g.13: Crambin-like [57428] (1 superfamily)
  4. 40611Superfamily g.13.1: Crambin-like [57429] (1 family) (S)
  5. 40612Family g.13.1.1: Crambin-like [57430] (4 proteins)
  6. 40613Protein alpha-1-Purothionin [57435] (1 species)
  7. 40614Species Wheat (Triticum aestivum) [TaxId:4565] [57436] (1 PDB entry)
  8. 40615Domain d2plh__: 2plh - [44627]

Details for d2plh__

PDB Entry: 2plh (more details), 2.5 Å

PDB Description: structure of alpha-1-purothionin at room temperature and 2.8 angstroms resolution

SCOP Domain Sequences for d2plh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plh__ g.13.1.1 (-) alpha-1-Purothionin {Wheat (Triticum aestivum)}
ksccrstlgrncynlcrargaqklcagvcrckissglscpkgfpk

SCOP Domain Coordinates for d2plh__:

Click to download the PDB-style file with coordinates for d2plh__.
(The format of our PDB-style files is described here.)

Timeline for d2plh__: