Lineage for d1bhpa_ (1bhp A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637943Fold g.13: Crambin-like [57428] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637944Superfamily g.13.1: Crambin-like [57429] (1 family) (S)
    automatically mapped to Pfam PF00321
  5. 2637945Family g.13.1.1: Crambin-like [57430] (10 proteins)
  6. 2637949Protein beta-Purothionin [57433] (1 species)
  7. 2637950Species Wheat (Triticum aestivum) [TaxId:4565] [57434] (1 PDB entry)
  8. 2637951Domain d1bhpa_: 1bhp A: [44626]
    complexed with act, gol, po4

Details for d1bhpa_

PDB Entry: 1bhp (more details), 1.7 Å

PDB Description: structure of beta-purothionin at room temperature and 1.7 angstroms resolution
PDB Compounds: (A:) beta-purothionin

SCOPe Domain Sequences for d1bhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhpa_ g.13.1.1 (A:) beta-Purothionin {Wheat (Triticum aestivum) [TaxId: 4565]}
kscckstlgrncynlcrargaqklcanvcrckltsglscpkdfpk

SCOPe Domain Coordinates for d1bhpa_:

Click to download the PDB-style file with coordinates for d1bhpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bhpa_: