Class g: Small proteins [56992] (98 folds) |
Fold g.13: Crambin-like [57428] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.13.1: Crambin-like [57429] (1 family) automatically mapped to Pfam PF00321 |
Family g.13.1.1: Crambin-like [57430] (10 proteins) |
Protein beta-Purothionin [57433] (1 species) |
Species Wheat (Triticum aestivum) [TaxId:4565] [57434] (1 PDB entry) |
Domain d1bhpa_: 1bhp A: [44626] complexed with act, gol, po4 |
PDB Entry: 1bhp (more details), 1.7 Å
SCOPe Domain Sequences for d1bhpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhpa_ g.13.1.1 (A:) beta-Purothionin {Wheat (Triticum aestivum) [TaxId: 4565]} kscckstlgrncynlcrargaqklcanvcrckltsglscpkdfpk
Timeline for d1bhpa_: