Lineage for d1ldra_ (1ldr A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890850Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 890851Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 890852Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 890862Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 890863Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries)
    Uniprot P01130 272-353
  8. 890875Domain d1ldra_: 1ldr A: [44616]
    second module

Details for d1ldra_

PDB Entry: 1ldr (more details)

PDB Description: second repeat of the ldl receptor ligand-binding domain
PDB Compounds: (A:) low-density lipoprotein receptor

SCOP Domain Sequences for d1ldra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldra_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
lsvtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc

SCOP Domain Coordinates for d1ldra_:

Click to download the PDB-style file with coordinates for d1ldra_.
(The format of our PDB-style files is described here.)

Timeline for d1ldra_: