![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
![]() | Superfamily g.12.1: LDL receptor-like module [57424] (1 family) ![]() |
![]() | Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
![]() | Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries) Uniprot P01130 272-353 |
![]() | Domain d1ldra_: 1ldr A: [44616] second module |
PDB Entry: 1ldr (more details)
SCOP Domain Sequences for d1ldra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldra_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} lsvtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc
Timeline for d1ldra_: