SCOP 1.73: Domain d1ldra_: 1ldr A:

Lineage for d1ldra_ (1ldr A:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (1 family)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries)

8. Domain d1ldra_: 1ldr A: [44616]
   second module

Details for d1ldra_

PDB Entry: 1ldr

PDB Description: second repeat of the ldl receptor ligand-binding domain

PDB Compounds: (A:) low-density lipoprotein receptor

SCOP Domain Sequences for d1ldra_:

Sequence; same for both SEQRES and ATOM records:

>d1ldra_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
lsvtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc

Timeline for d1ldra_:

• d1ldra_ first appeared (with stable ids) in SCOP 1.55, called d1ldr__
  
• d1ldra_ was called d1ldr__ in SCOP 1.71
  
• d1ldra_ appears in SCOP 1.75
  
• d1ldra_ appears in the current release, SCOPe 2.08