![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
![]() | Superfamily g.12.1: LDL receptor-like module [57424] (2 families) ![]() |
![]() | Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
![]() | Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries) Uniprot P01130 272-353 |
![]() | Domain d1d2la1: 1d2l A:3-45 [44614] Other proteins in same PDB: d1d2la2 complement-like repeat cr3 complexed with ca |
PDB Entry: 1d2l (more details)
SCOPe Domain Sequences for d1d2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2la1 g.12.1.1 (A:3-45) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} ppqcqpgefacansrciqerwkcdgdndcldnsdeapalchqh
Timeline for d1d2la1: