SCOPe 2.01: Domain d1f5ya2: 1f5y A:45-85

Lineage for d1f5ya2 (1f5y A:45-85)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (1 family)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (12 PDB entries)
   Uniprot P01130 272-353

8. Domain d1f5ya2: 1f5y A:45-85 [44611]
   a concatemer of the first and second modules
   complexed with ca

Details for d1f5ya2

PDB Entry: 1f5y

PDB Description: nmr structure of a concatemer of the first and second ligand-binding modules of the human ldl receptor

PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1f5ya2:

Sequence; same for both SEQRES and ATOM records:

>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
lsvtcksgdfscggrvnrcipqfwrcdgqvdcdngsdeqgc

Timeline for d1f5ya2:

• d1f5ya2 first appeared (with stable ids) in SCOP 1.55
  
• d1f5ya2 appears in SCOP 1.75
  
• d1f5ya2 appears in SCOPe 2.02
  
• d1f5ya2 appears in the current release, SCOPe 2.08