Lineage for d1nk1b1 (1nk1 B:38-125)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 342936Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 342937Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulphide pattern
  5. 342938Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein)
  6. 342939Protein Hepatocyte growth factor [57416] (1 species)
    heparin-binding domain
  7. 342940Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries)
  8. 342950Domain d1nk1b1: 1nk1 B:38-125 [44606]
    Other proteins in same PDB: d1nk1a2, d1nk1b2
    mutant

Details for d1nk1b1

PDB Entry: 1nk1 (more details), 2.5 Å

PDB Description: nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution

SCOP Domain Sequences for d1nk1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk1b1 g.10.1.1 (B:38-125) Hepatocyte growth factor {Human (Homo sapiens)}
tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
wfpfnsmssgvkkefghefdlyenkdyi

SCOP Domain Coordinates for d1nk1b1:

Click to download the PDB-style file with coordinates for d1nk1b1.
(The format of our PDB-style files is described here.)

Timeline for d1nk1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nk1b2