Class g: Small proteins [56992] (66 folds) |
Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) the middle part is structurally similar to some knottins and defensins but differs in the disulphide pattern |
Family g.10.1.1: Hairpin loop containing domain [57415] (1 protein) |
Protein Hepatocyte growth factor [57416] (1 species) heparin-binding domain |
Species Human (Homo sapiens) [TaxId:9606] [57417] (6 PDB entries) |
Domain d1nk1b1: 1nk1 B:38-125 [44606] Other proteins in same PDB: d1nk1a2, d1nk1b2 mutant |
PDB Entry: 1nk1 (more details), 2.5 Å
SCOP Domain Sequences for d1nk1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nk1b1 g.10.1.1 (B:38-125) Hepatocyte growth factor {Human (Homo sapiens)} tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl wfpfnsmssgvkkefghefdlyenkdyi
Timeline for d1nk1b1: