Lineage for d1nk1a1 (1nk1 A:38-125)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40580Fold g.10: Hairpin loop containing domain of hepatocyte growth factor [57413] (1 superfamily)
  4. 40581Superfamily g.10.1: Hairpin loop containing domain of hepatocyte growth factor [57414] (1 family) (S)
  5. 40582Family g.10.1.1: Hairpin loop containing domain of hepatocyte growth factor [57415] (1 protein)
  6. 40583Protein Hairpin loop containing domain of hepatocyte growth factor [57416] (1 species)
  7. 40584Species Human (Homo sapiens) [TaxId:9606] [57417] (3 PDB entries)
  8. 40587Domain d1nk1a1: 1nk1 A:38-125 [44605]
    Other proteins in same PDB: d1nk1a2, d1nk1b2

Details for d1nk1a1

PDB Entry: 1nk1 (more details), 2.5 Å

PDB Description: nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution

SCOP Domain Sequences for d1nk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk1a1 g.10.1.1 (A:38-125) Hairpin loop containing domain of hepatocyte growth factor {Human (Homo sapiens)}
tihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkqcl
wfpfnsmssgvkkefghefdlyenkdyi

SCOP Domain Coordinates for d1nk1a1:

Click to download the PDB-style file with coordinates for d1nk1a1.
(The format of our PDB-style files is described here.)

Timeline for d1nk1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nk1a2