Lineage for d1bhtb1 (1bht B:336-426)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40580Fold g.10: Hairpin loop containing domain of hepatocyte growth factor [57413] (1 superfamily)
  4. 40581Superfamily g.10.1: Hairpin loop containing domain of hepatocyte growth factor [57414] (1 family) (S)
  5. 40582Family g.10.1.1: Hairpin loop containing domain of hepatocyte growth factor [57415] (1 protein)
  6. 40583Protein Hairpin loop containing domain of hepatocyte growth factor [57416] (1 species)
  7. 40584Species Human (Homo sapiens) [TaxId:9606] [57417] (3 PDB entries)
  8. 40586Domain d1bhtb1: 1bht B:336-426 [44604]
    Other proteins in same PDB: d1bhta2, d1bhtb2

Details for d1bhtb1

PDB Entry: 1bht (more details), 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor

SCOP Domain Sequences for d1bhtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhtb1 g.10.1.1 (B:336-426) Hairpin loop containing domain of hepatocyte growth factor {Human (Homo sapiens)}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

SCOP Domain Coordinates for d1bhtb1:

Click to download the PDB-style file with coordinates for d1bhtb1.
(The format of our PDB-style files is described here.)

Timeline for d1bhtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bhtb2