SCOP 1.55: Domain d1bhtb1: 1bht B:336-426

Lineage for d1bhtb1 (1bht B:336-426)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.10: Hairpin loop containing domain of hepatocyte growth factor [57413] (1 superfamily)

4. Superfamily g.10.1: Hairpin loop containing domain of hepatocyte growth factor [57414] (1 family)

5. Family g.10.1.1: Hairpin loop containing domain of hepatocyte growth factor [57415] (1 protein)

6. Protein Hairpin loop containing domain of hepatocyte growth factor [57416] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (3 PDB entries)

8. Domain d1bhtb1: 1bht B:336-426 [44604]
   Other proteins in same PDB: d1bhta2, d1bhtb2

Details for d1bhtb1

PDB Entry: 1bht, 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor

SCOP Domain Sequences for d1bhtb1:

Sequence; same for both SEQRES and ATOM records:

>d1bhtb1 g.10.1.1 (B:336-426) Hairpin loop containing domain of hepatocyte growth factor {Human (Homo sapiens)}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d1bhtb1:

• d1bhtb1 appears in SCOP 1.57
  
• d1bhtb1 appears in the current release, SCOPe 2.08