Lineage for d1bhtb1 (1bht B:336-426)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. Protein Hepatocyte growth factor [57416] (1 species)
    heparin-binding domain
  7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)
  8. Domain d1bhtb1: 1bht B:336-426 [44604]
    Other proteins in same PDB: d1bhta2, d1bhtb2
    complexed with epe, so4

Details for d1bhtb1

PDB Entry: 1bht (more details), 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d1bhtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhtb1 g.10.1.1 (B:336-426) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkarkq
clwfpfnsmssgvkkefghefdlyenkdyir

SCOPe Domain Coordinates for d1bhtb1 are not available.

Timeline for d1bhtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bhtb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1bhta1, d1bhta2