Lineage for d1bhta1 (1bht A:35-126)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637806Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
    alpha+beta fold with two crossing loops
  4. 2637807Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) (S)
    the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern
  5. 2637808Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
    automatically mapped to Pfam PF00024
  6. 2637809Protein Hepatocyte growth factor [57416] (1 species)
    heparin-binding domain
  7. 2637810Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)
  8. 2637818Domain d1bhta1: 1bht A:35-126 [44603]
    Other proteins in same PDB: d1bhta2, d1bhtb2
    complexed with epe, so4

Details for d1bhta1

PDB Entry: 1bht (more details), 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor
PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d1bhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhta1 g.10.1.1 (A:35-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
qclwfpfnsmssgvkkefghefdlyenkdyir

SCOPe Domain Coordinates for d1bhta1:

Click to download the PDB-style file with coordinates for d1bhta1.
(The format of our PDB-style files is described here.)

Timeline for d1bhta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bhta2