SCOPe 2.06: Domain d1bhta1: 1bht A:35-126

Lineage for d1bhta1 (1bht A:35-126)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein Hepatocyte growth factor [57416] (1 species)
   heparin-binding domain

7. Species Human (Homo sapiens) [TaxId:9606] [57417] (21 PDB entries)

8. Domain d1bhta1: 1bht A:35-126 [44603]
   Other proteins in same PDB: d1bhta2, d1bhtb2
   complexed with epe, so4

Details for d1bhta1

PDB Entry: 1bht, 2 Å

PDB Description: nk1 fragment of human hepatocyte growth factor

PDB Compounds: (A:) hepatocyte growth factor

SCOPe Domain Sequences for d1bhta1:

Sequence; same for both SEQRES and ATOM records:

>d1bhta1 g.10.1.1 (A:35-126) Hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rrntihefkksakttlikidpalkiktkkvntadqcanrctrnkglpftckafvfdkark
qclwfpfnsmssgvkkefghefdlyenkdyir

Timeline for d1bhta1:

• d1bhta1 first appeared (with stable ids) in SCOP 1.55
  
• d1bhta1 appears in SCOPe 2.05
  
• d1bhta1 appears in SCOPe 2.07
  
• d1bhta1 appears in the current release, SCOPe 2.08