Lineage for d1fd4j_ (1fd4 J:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890710Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 890711Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 890712Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 890726Protein Beta-defensin, BD [63384] (7 species)
  7. 890738Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 890752Domain d1fd4j_: 1fd4 J: [44585]

Details for d1fd4j_

PDB Entry: 1fd4 (more details), 1.7 Å

PDB Description: human beta-defensin 2
PDB Compounds: (J:) beta-defensin 2

SCOP Domain Sequences for d1fd4j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd4j_ g.9.1.1 (J:) Beta-defensin, BD {Human (Homo sapiens), HBD2 [TaxId: 9606]}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1fd4j_:

Click to download the PDB-style file with coordinates for d1fd4j_.
(The format of our PDB-style files is described here.)

Timeline for d1fd4j_: