| Class g: Small proteins [56992] (100 folds) |
| Fold g.9: Defensin-like [57391] (1 superfamily) Disulfide-rich fold, nearly all-beta |
Superfamily g.9.1: Defensin-like [57392] (3 families) ![]() |
| Family g.9.1.1: Defensin [57393] (11 proteins) |
| Protein Beta-defensin, BD [63384] (7 species) |
| Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (5 PDB entries) |
| Domain d1fd4j_: 1fd4 J: [44585] complexed with so4 |
PDB Entry: 1fd4 (more details), 1.7 Å
SCOPe Domain Sequences for d1fd4j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fd4j_ g.9.1.1 (J:) Beta-defensin, BD {Human (Homo sapiens), HBD2 [TaxId: 9606]}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp
Timeline for d1fd4j_: