Lineage for d1fd4c_ (1fd4 C:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 622978Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 622979Superfamily g.9.1: Defensin-like [57392] (2 families) (S)
  5. 622980Family g.9.1.1: Defensin [57393] (10 proteins)
  6. 622994Protein Beta-defensin, BD [63384] (7 species)
  7. 623006Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 623013Domain d1fd4c_: 1fd4 C: [44578]

Details for d1fd4c_

PDB Entry: 1fd4 (more details), 1.7 Å

PDB Description: human beta-defensin 2

SCOP Domain Sequences for d1fd4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd4c_ g.9.1.1 (C:) Beta-defensin, BD {Human (Homo sapiens), HBD2}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1fd4c_:

Click to download the PDB-style file with coordinates for d1fd4c_.
(The format of our PDB-style files is described here.)

Timeline for d1fd4c_: