Lineage for d1fd4b_ (1fd4 B:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1063494Fold g.9: Defensin-like [57391] (1 superfamily)
    Disulfide-rich fold, nearly all-beta
  4. 1063495Superfamily g.9.1: Defensin-like [57392] (3 families) (S)
  5. 1063496Family g.9.1.1: Defensin [57393] (11 proteins)
  6. 1063510Protein Beta-defensin, BD [63384] (7 species)
  7. 1063522Species Human (Homo sapiens), HBD2 [TaxId:9606] [63385] (4 PDB entries)
  8. 1063528Domain d1fd4b_: 1fd4 B: [44577]
    complexed with so4

Details for d1fd4b_

PDB Entry: 1fd4 (more details), 1.7 Å

PDB Description: human beta-defensin 2
PDB Compounds: (B:) beta-defensin 2

SCOPe Domain Sequences for d1fd4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd4b_ g.9.1.1 (B:) Beta-defensin, BD {Human (Homo sapiens), HBD2 [TaxId: 9606]}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOPe Domain Coordinates for d1fd4b_:

Click to download the PDB-style file with coordinates for d1fd4b_.
(The format of our PDB-style files is described here.)

Timeline for d1fd4b_: