Lineage for d1fd4b_ (1fd4 B:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40525Fold g.9: Defensin-like [57391] (1 superfamily)
  4. 40526Superfamily g.9.1: Defensin-like [57392] (1 family) (S)
  5. 40527Family g.9.1.1: Defensin [57393] (9 proteins)
  6. 40541Protein Beta-defensin 2 [57396] (1 species)
  7. 40542Species Human (Homo sapiens) [TaxId:9606] [57397] (2 PDB entries)
  8. 40548Domain d1fd4b_: 1fd4 B: [44577]

Details for d1fd4b_

PDB Entry: 1fd4 (more details), 1.7 Å

PDB Description: human beta-defensin 2

SCOP Domain Sequences for d1fd4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd4b_ g.9.1.1 (B:) Beta-defensin 2 {Human (Homo sapiens)}
gigdpvtclksgaichpvfcprrykqigtcglpgtkcckkp

SCOP Domain Coordinates for d1fd4b_:

Click to download the PDB-style file with coordinates for d1fd4b_.
(The format of our PDB-style files is described here.)

Timeline for d1fd4b_: