Lineage for d1tcp__ (1tcp -)
- Root: SCOP 1.57
Class g: Small proteins [56992] (56 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily) Superfamily g.8.1: BPTI-like [57362] (2 families) 
Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins) Protein Anticoagulant protein, factor Xa inhibitor [57389] (1 species) Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57390] (4 PDB entries) 
Domain d1tcp__: 1tcp - [44568]
Details for d1tcp__
PDB Entry: 1tcp (more details)
PDB Description: nmr structure determination of tick anticoagulant peptide (tap)
SCOP Domain Sequences for d1tcp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tcp__ g.8.1.2 (-) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata)}
ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci
SCOP Domain Coordinates for d1tcp__:
Click to download the PDB-style file with coordinates for d1tcp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tcp__:
- d1tcp__ first appeared (with stable ids) in SCOP 1.55
- d1tcp__ appears in SCOP 1.59
- d1tcp__ appears in the current release, SCOPe 2.08, called d1tcpa_
View in 3D