Lineage for d1kigi_ (1kig I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583928Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2583929Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2584171Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 2584172Protein Anticoagulant protein, factor Xa inhibitor [57389] (1 species)
  7. 2584173Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57390] (4 PDB entries)
  8. 2584175Domain d1kigi_: 1kig I: [44567]
    Other proteins in same PDB: d1kigh_, d1kigl_

Details for d1kigi_

PDB Entry: 1kig (more details), 3 Å

PDB Description: bovine factor xa
PDB Compounds: (I:) anticoagulant peptide

SCOPe Domain Sequences for d1kigi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kigi_ g.8.1.2 (I:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci

SCOPe Domain Coordinates for d1kigi_:

Click to download the PDB-style file with coordinates for d1kigi_.
(The format of our PDB-style files is described here.)

Timeline for d1kigi_: