Lineage for d1d0da_ (1d0d A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962426Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1962427Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1962667Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 1962668Protein Anticoagulant protein, factor Xa inhibitor [57389] (1 species)
  7. 1962669Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57390] (4 PDB entries)
  8. 1962670Domain d1d0da_: 1d0d A: [44566]
    Other proteins in same PDB: d1d0db_
    complexed with so4

Details for d1d0da_

PDB Entry: 1d0d (more details), 1.62 Å

PDB Description: crystal structure of tick anticoagulant protein complexed with bovine pancreatic trypsin inhibitor
PDB Compounds: (A:) anticoagulant protein

SCOPe Domain Sequences for d1d0da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0da_ g.8.1.2 (A:) Anticoagulant protein, factor Xa inhibitor {Soft tick (Ornithodoros moubata) [TaxId: 6938]}
ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci

SCOPe Domain Coordinates for d1d0da_:

Click to download the PDB-style file with coordinates for d1d0da_.
(The format of our PDB-style files is described here.)

Timeline for d1d0da_: