Lineage for d1tocs1 (1toc S:1A-56)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522416Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 522417Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 522567Family g.8.1.2: Soft tick anticoagulant proteins [57386] (2 proteins)
  6. 522574Protein Ornithodorin [57387] (1 species)
    duplication: consists of two BPTI-like domains
  7. 522575Species Soft tick (Ornithodoros moubata) [TaxId:6938] [57388] (1 PDB entry)
  8. 522578Domain d1tocs1: 1toc S:1A-56 [44560]
    Other proteins in same PDB: d1toc.1, d1toc.2, d1toc.3, d1toc.4

Details for d1tocs1

PDB Entry: 1toc (more details), 3.1 Å

PDB Description: structure of serine proteinase

SCOP Domain Sequences for d1tocs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tocs1 g.8.1.2 (S:1A-56) Ornithodorin {Soft tick (Ornithodoros moubata)}
slnvlcnnphtadcnndaqvdryfregttclmspactsegyasqhecqqacfvgged

SCOP Domain Coordinates for d1tocs1:

Click to download the PDB-style file with coordinates for d1tocs1.
(The format of our PDB-style files is described here.)

Timeline for d1tocs1: