Lineage for d1dtk__ (1dtk -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40392Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 40393Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 40394Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 40425Protein Dendrotoxin K [57380] (1 species)
  7. 40426Species Black mamba (Dendroaspis polylepis polylepis) [TaxId:8620] [57381] (1 PDB entry)
  8. 40427Domain d1dtk__: 1dtk - [44554]

Details for d1dtk__

PDB Entry: 1dtk (more details)

PDB Description: the nmr solution structure of dendrotoxin k from the venom of dendroaspis polylepis polylepis

SCOP Domain Sequences for d1dtk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtk__ g.8.1.1 (-) Dendrotoxin K {Black mamba (Dendroaspis polylepis polylepis)}
aakycklplrigpckrkipsfyykwkakqclpfdysgcggnanrfktieecrrtcvg

SCOP Domain Coordinates for d1dtk__:

Click to download the PDB-style file with coordinates for d1dtk__.
(The format of our PDB-style files is described here.)

Timeline for d1dtk__: