Lineage for d1shp__ (1shp -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89428Protein Trypsin inhibitor [57378] (1 species)
  7. 89429Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [57379] (1 PDB entry)
  8. 89430Domain d1shp__: 1shp - [44553]

Details for d1shp__

PDB Entry: 1shp (more details)

PDB Description: the nmr solution structure of a kunitz-type proteinase inhibitor from the sea anemone stichodactyla helianthus

SCOP Domain Sequences for d1shp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shp__ g.8.1.1 (-) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus)}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra

SCOP Domain Coordinates for d1shp__:

Click to download the PDB-style file with coordinates for d1shp__.
(The format of our PDB-style files is described here.)

Timeline for d1shp__: