Lineage for d1shpa_ (1shp A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032705Protein Trypsin inhibitor [57378] (1 species)
  7. 3032706Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [57379] (1 PDB entry)
  8. 3032707Domain d1shpa_: 1shp A: [44553]

Details for d1shpa_

PDB Entry: 1shp (more details)

PDB Description: the nmr solution structure of a kunitz-type proteinase inhibitor from the sea anemone stichodactyla helianthus
PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d1shpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1shpa_ g.8.1.1 (A:) Trypsin inhibitor {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
sicsepkkvgrckgyfprfyfdsetgkctpfiyggcggngnnfetlhqcraicra

SCOPe Domain Coordinates for d1shpa_:

Click to download the PDB-style file with coordinates for d1shpa_.
(The format of our PDB-style files is described here.)

Timeline for d1shpa_: