![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
![]() | Superfamily g.8.1: BPTI-like [57362] (2 families) ![]() |
![]() | Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (12 proteins) |
![]() | Protein beta2-bungarotoxin, neurotoxin chain [57376] (1 species) |
![]() | Species Many-banded krait (elapid) (Bungarus multicinctus) [57377] (1 PDB entry) |
![]() | Domain d1bunb_: 1bun B: [44552] Other proteins in same PDB: d1buna_ complexed with na |
PDB Entry: 1bun (more details), 2.45 Å
SCOP Domain Sequences for d1bunb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (elapid) (Bungarus multicinctus)} rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley r
Timeline for d1bunb_: