Lineage for d1bunb_ (1bun B:)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89306Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 89307Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 89308Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 89320Protein beta2-bungarotoxin, neurotoxin chain [57376] (1 species)
  7. 89321Species Many-banded krait (elapid) (Bungarus multicinctus) [57377] (1 PDB entry)
  8. 89322Domain d1bunb_: 1bun B: [44552]
    Other proteins in same PDB: d1buna_

Details for d1bunb_

PDB Entry: 1bun (more details), 2.45 Å

PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action

SCOP Domain Sequences for d1bunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (elapid) (Bungarus multicinctus)}
rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
r

SCOP Domain Coordinates for d1bunb_:

Click to download the PDB-style file with coordinates for d1bunb_.
(The format of our PDB-style files is described here.)

Timeline for d1bunb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1buna_