Lineage for d1bunb_ (1bun B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.8: BPTI-like [57361] (1 superfamily) Superfamily g.8.1: BPTI-like [57362] (2 families) 
Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins) 
Protein beta2-bungarotoxin, neurotoxin chain [57376] (1 species) Species Many-banded krait (elapid) (Bungarus multicinctus) [57377] (1 PDB entry) 
Domain d1bunb_: 1bun B: [44552]
Other proteins in same PDB: d1buna_
Details for d1bunb_
PDB Entry: 1bun (more details), 2.45 Å
PDB Description: structure of beta2-bungarotoxin: potassium channel binding by kunitz modules and targeted phospholipase action
SCOP Domain Sequences for d1bunb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bunb_ g.8.1.1 (B:) beta2-bungarotoxin, neurotoxin chain {Many-banded krait (elapid) (Bungarus multicinctus)}
rkrhpdcdkppdtkicqtvvrafyykpsakrcvqfryggcngngnhfksdhlcrcecley
r
SCOP Domain Coordinates for d1bunb_:
Click to download the PDB-style file with coordinates for d1bunb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bunb_:
- d1bunb_ appears in SCOP 1.57
- d1bunb_ appears in the current release, SCOPe 2.08
View in 3D
