SCOPe 2.07: Domain d1dtxa_: 1dtx A:

Lineage for d1dtxa_ (1dtx A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein alpha-Dendrotoxin [57374] (1 species)

7. Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57375] (1 PDB entry)

8. Domain d1dtxa_: 1dtx A: [44551]
   complexed with so4

Details for d1dtxa_

PDB Entry: 1dtx, 2.2 Å

PDB Description: crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor

PDB Compounds: (A:) alpha-dendrotoxin

SCOPe Domain Sequences for d1dtxa_:

Sequence; same for both SEQRES and ATOM records:

>d1dtxa_ g.8.1.1 (A:) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps) [TaxId: 8618]}
eprrklcilhrnpgrcydkipafyynqkkkqcerfdwsgcggnsnrfktieecrrtcig

Timeline for d1dtxa_:

• d1dtxa_ first appeared (with stable ids) in SCOP 1.55, called d1dtx__
  
• d1dtxa_ appears in SCOPe 2.06
  
• d1dtxa_ appears in the current release, SCOPe 2.08