Class g: Small proteins [56992] (66 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulphide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (2 families) |
Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (12 proteins) |
Protein alpha-Dendrotoxin [57374] (1 species) |
Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57375] (1 PDB entry) |
Domain d1dtx__: 1dtx - [44551] complexed with so4 |
PDB Entry: 1dtx (more details), 2.2 Å
SCOP Domain Sequences for d1dtx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dtx__ g.8.1.1 (-) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps)} eprrklcilhrnpgrcydkipafyynqkkkqcerfdwsgcggnsnrfktieecrrtcig
Timeline for d1dtx__: