SCOP 1.57: Domain d1dtx__: 1dtx -

Lineage for d1dtx__ (1dtx -)

1. Root: SCOP 1.57

2. Class g: Small proteins [56992] (56 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)

4. Superfamily g.8.1: BPTI-like [57362] (2 families)

5. Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)

6. Protein alpha-Dendrotoxin [57374] (1 species)

7. Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57375] (1 PDB entry)

8. Domain d1dtx__: 1dtx - [44551]

Details for d1dtx__

PDB Entry: 1dtx, 2.2 Å

PDB Description: crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d1dtx__:

Sequence; same for both SEQRES and ATOM records:

>d1dtx__ g.8.1.1 (-) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps)}
eprrklcilhrnpgrcydkipafyynqkkkqcerfdwsgcggnsnrfktieecrrtcig

Timeline for d1dtx__:

• d1dtx__ first appeared (with stable ids) in SCOP 1.55
  
• d1dtx__ appears in SCOP 1.59
  
• d1dtx__ appears in the current release, SCOPe 2.08, called d1dtxa_