Lineage for d1dtx__ (1dtx -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40392Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 40393Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 40394Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 40395Protein alpha-Dendrotoxin [57374] (1 species)
  7. 40396Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57375] (1 PDB entry)
  8. 40397Domain d1dtx__: 1dtx - [44551]

Details for d1dtx__

PDB Entry: 1dtx (more details), 2.2 Å

PDB Description: crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d1dtx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtx__ g.8.1.1 (-) alpha-Dendrotoxin {Green mamba (Dendroaspis angusticeps)}
eprrklcilhrnpgrcydkipafyynqkkkqcerfdwsgcggnsnrfktieecrrtcig

SCOP Domain Coordinates for d1dtx__:

Click to download the PDB-style file with coordinates for d1dtx__.
(The format of our PDB-style files is described here.)

Timeline for d1dtx__: