Lineage for d1bika2 (1bik A:79-134)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032536Protein Bikunin from inter-alpha-inhibitor complex [57372] (1 species)
  7. 3032537Species Human (Homo sapiens) [TaxId:9606] [57373] (1 PDB entry)
  8. 3032539Domain d1bika2: 1bik A:79-134 [44550]
    complexed with nag, so4

Details for d1bika2

PDB Entry: 1bik (more details), 2.5 Å

PDB Description: x-ray structure of bikunin from the human inter-alpha-inhibitor complex
PDB Compounds: (A:) bikunin

SCOPe Domain Sequences for d1bika2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bika2 g.8.1.1 (A:79-134) Bikunin from inter-alpha-inhibitor complex {Human (Homo sapiens) [TaxId: 9606]}
vaacnlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycgv

SCOPe Domain Coordinates for d1bika2:

Click to download the PDB-style file with coordinates for d1bika2.
(The format of our PDB-style files is described here.)

Timeline for d1bika2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bika1