Lineage for d1brci_ (1brc I:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143616Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 143617Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)
  8. 143623Domain d1brci_: 1brc I: [44548]
    Other proteins in same PDB: d1brce_

Details for d1brci_

PDB Entry: 1brc (more details), 2.5 Å

PDB Description: relocating a negative charge in the binding pocket of trypsin

SCOP Domain Sequences for d1brci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brci_ g.8.1.1 (I:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens)}
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOP Domain Coordinates for d1brci_:

Click to download the PDB-style file with coordinates for d1brci_.
(The format of our PDB-style files is described here.)

Timeline for d1brci_:

143623
d1brci_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1brce_