| Class g: Small proteins [56992] (61 folds) |
| Fold g.8: BPTI-like [57361] (1 superfamily) disulphide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (2 families) ![]() |
| Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins) |
| Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries) |
| Domain d1tawb_: 1taw B: [44545] Other proteins in same PDB: d1tawa_ complexed with ca |
PDB Entry: 1taw (more details), 1.8 Å
SCOP Domain Sequences for d1tawb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tawb_ g.8.1.1 (B:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens)}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg
Timeline for d1tawb_: