Lineage for d1tawb_ (1taw B:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143616Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 143617Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)
  8. 143620Domain d1tawb_: 1taw B: [44545]
    Other proteins in same PDB: d1tawa_

Details for d1tawb_

PDB Entry: 1taw (more details), 1.8 Å

PDB Description: bovine trypsin complexed to appi

SCOP Domain Sequences for d1tawb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tawb_ g.8.1.1 (B:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens)}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOP Domain Coordinates for d1tawb_:

Click to download the PDB-style file with coordinates for d1tawb_.
(The format of our PDB-style files is described here.)

Timeline for d1tawb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tawa_