Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries) |
Domain d1tawb_: 1taw B: [44545] Other proteins in same PDB: d1tawa_ complexed with ca |
PDB Entry: 1taw (more details), 1.8 Å
SCOPe Domain Sequences for d1tawb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tawb_ g.8.1.1 (B:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]} evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg
Timeline for d1tawb_: