SCOPe 2.08: Domain d1aapb_: 1aap B:

Lineage for d1aapb_ (1aap B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)

8. Domain d1aapb_: 1aap B: [44544]

Details for d1aapb_

PDB Entry: 1aap, 1.5 Å

PDB Description: x-ray crystal structure of the protease inhibitor domain of alzheimer's amyloid beta-protein precursor

PDB Compounds: (B:) alzheimer's disease amyloid a4 protein

SCOPe Domain Sequences for d1aapb_:

Sequence; same for both SEQRES and ATOM records:

>d1aapb_ g.8.1.1 (B:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

Timeline for d1aapb_:

• d1aapb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aapb_ appears in SCOPe 2.07