Lineage for d1aapa_ (1aap A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143616Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 143617Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)
  8. 143618Domain d1aapa_: 1aap A: [44543]

Details for d1aapa_

PDB Entry: 1aap (more details), 1.5 Å

PDB Description: x-ray crystal structure of the protease inhibitor domain of alzheimer's amyloid beta-protein precursor

SCOP Domain Sequences for d1aapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aapa_ g.8.1.1 (A:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens)}
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOP Domain Coordinates for d1aapa_:

Click to download the PDB-style file with coordinates for d1aapa_.
(The format of our PDB-style files is described here.)

Timeline for d1aapa_:

143618
d1aapa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1aapb_