SCOP 1.59: Domain d1tfxd_: 1tfx D:

Lineage for d1tfxd_ (1tfx D:)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)

4. Superfamily g.8.1: BPTI-like [57362] (2 families)

5. Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)

6. Protein Tissue factor pathway inhibitor [57368] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57369] (3 PDB entries)

8. Domain d1tfxd_: 1tfx D: [44541]
   Other proteins in same PDB: d1tfxa_, d1tfxb_

Details for d1tfxd_

PDB Entry: 1tfx, 2.6 Å

PDB Description: complex of the second kunitz domain of tissue factor pathway inhibitor with porcine trypsin

SCOP Domain Sequences for d1tfxd_:

Sequence; same for both SEQRES and ATOM records:

>d1tfxd_ g.8.1.1 (D:) Tissue factor pathway inhibitor {Human (Homo sapiens)}
kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

Timeline for d1tfxd_:

• d1tfxd_ first appeared (with stable ids) in SCOP 1.55
  
• d1tfxd_ appears in SCOP 1.57
  
• d1tfxd_ appears in SCOP 1.61
  
• d1tfxd_ appears in the current release, SCOPe 2.08