Class g: Small proteins [56992] (98 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein Tissue factor pathway inhibitor [57368] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries) |
Domain d1tfxc_: 1tfx C: [44540] Other proteins in same PDB: d1tfxa_, d1tfxb_ second kunitz domain complexed with ca |
PDB Entry: 1tfx (more details), 2.6 Å
SCOPe Domain Sequences for d1tfxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]} kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg
Timeline for d1tfxc_: