Lineage for d1tfxc_ (1tfx C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637448Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 2637449Species Human (Homo sapiens) [TaxId:9606] [57369] (4 PDB entries)
  8. 2637452Domain d1tfxc_: 1tfx C: [44540]
    Other proteins in same PDB: d1tfxa_, d1tfxb_
    second kunitz domain
    complexed with ca

Details for d1tfxc_

PDB Entry: 1tfx (more details), 2.6 Å

PDB Description: complex of the second kunitz domain of tissue factor pathway inhibitor with porcine trypsin
PDB Compounds: (C:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d1tfxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens) [TaxId: 9606]}
kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

SCOPe Domain Coordinates for d1tfxc_:

Click to download the PDB-style file with coordinates for d1tfxc_.
(The format of our PDB-style files is described here.)

Timeline for d1tfxc_: