Lineage for d1tfxc_ (1tfx C:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143610Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 143611Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 143612Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 143731Protein Tissue factor pathway inhibitor [57368] (1 species)
  7. 143732Species Human (Homo sapiens) [TaxId:9606] [57369] (3 PDB entries)
  8. 143733Domain d1tfxc_: 1tfx C: [44540]
    Other proteins in same PDB: d1tfxa_, d1tfxb_

Details for d1tfxc_

PDB Entry: 1tfx (more details), 2.6 Å

PDB Description: complex of the second kunitz domain of tissue factor pathway inhibitor with porcine trypsin

SCOP Domain Sequences for d1tfxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfxc_ g.8.1.1 (C:) Tissue factor pathway inhibitor {Human (Homo sapiens)}
kpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

SCOP Domain Coordinates for d1tfxc_:

Click to download the PDB-style file with coordinates for d1tfxc_.
(The format of our PDB-style files is described here.)

Timeline for d1tfxc_: