Lineage for d1kuna_ (1kun A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637294Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)
  7. 2637295Species Human (Homo sapiens) [TaxId:9606] [57367] (6 PDB entries)
  8. 2637301Domain d1kuna_: 1kun A: [44539]

Details for d1kuna_

PDB Entry: 1kun (more details)

PDB Description: solution structure of the human alpha3-chain type vi collagen c- terminal kunitz domain, nmr, 20 structures
PDB Compounds: (A:) alpha3-chain type vi collagen

SCOPe Domain Sequences for d1kuna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuna_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]}
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv

SCOPe Domain Coordinates for d1kuna_:

Click to download the PDB-style file with coordinates for d1kuna_.
(The format of our PDB-style files is described here.)

Timeline for d1kuna_: