SCOP 1.55: Domain d1kun__: 1kun -

Lineage for d1kun__ (1kun -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)

4. Superfamily g.8.1: BPTI-like [57362] (2 families)

5. Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)

6. Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57367] (3 PDB entries)

8. Domain d1kun__: 1kun - [44539]

Details for d1kun__

PDB Entry: 1kun

PDB Description: solution structure of the human alpha3-chain type vi collagen c- terminal kunitz domain, nmr, 20 structures

SCOP Domain Sequences for d1kun__:

Sequence; same for both SEQRES and ATOM records:

>d1kun__ g.8.1.1 (-) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens)}
etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv

Timeline for d1kun__:

• d1kun__ appears in SCOP 1.57
  
• d1kun__ appears in the current release, SCOPe 2.08, called d1kuna_