SCOPe 2.08: Domain d1knta_: 1knt A:

Lineage for d1knta_ (1knt A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Collagen type VI (domain C5 from alpha 3 chain) [57366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57367] (6 PDB entries)

8. Domain d1knta_: 1knt A: [44538]
   complexed with so4

Details for d1knta_

PDB Entry: 1knt, 1.6 Å

PDB Description: the 1.6 angstroms structure of the kunitz-type domain from the alpha3 chain of the human type vi collagen

PDB Compounds: (A:) collagen type vi

SCOPe Domain Sequences for d1knta_:

Sequence; same for both SEQRES and ATOM records:

>d1knta_ g.8.1.1 (A:) Collagen type VI (domain C5 from alpha 3 chain) {Human (Homo sapiens) [TaxId: 9606]}
tdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvca

Timeline for d1knta_:

• d1knta_ first appeared (with stable ids) in SCOP 1.55, called d1knt__
  
• d1knta_ appears in SCOPe 2.07