Class g: Small proteins [56992] (94 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries) |
Domain d1bhch_: 1bhc H: [44530] dodecamer observed in the crystals complexed with scn |
PDB Entry: 1bhc (more details), 2.7 Å
SCOPe Domain Sequences for d1bhch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bhch_ g.8.1.1 (H:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]} rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg
Timeline for d1bhch_: