Lineage for d1bhcg_ (1bhc G:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40392Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 40393Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 40394Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 40428Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 40429Species Cow (Bos taurus) [TaxId:9913] [57365] (45 PDB entries)
  8. 40492Domain d1bhcg_: 1bhc G: [44529]

Details for d1bhcg_

PDB Entry: 1bhc (more details), 2.7 Å

PDB Description: bovine pancreatic trypsin inhibitor crystallized from thiocyanate

SCOP Domain Sequences for d1bhcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhcg_ g.8.1.1 (G:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus)}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

SCOP Domain Coordinates for d1bhcg_:

Click to download the PDB-style file with coordinates for d1bhcg_.
(The format of our PDB-style files is described here.)

Timeline for d1bhcg_: